PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G362500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 233aa    MW: 27310.1 Da    PI: 9.7865
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G362500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.6e-16855148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+W ++Ed+ll+++++++G g+W+ ++ + g++R++k+c++rw++yl
  Aqcoe1G362500.1.p  8 KGAWNQDEDLLLKRCIEKYGEGNWHQVPMRAGLNRCRKSCRLRWLNYL 55
                       79********************************************97 PP

2Myb_DNA-binding46.87.1e-1561106148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rg + ++E +l+ +++k+lG++ W++Ia +++ gRt++++k++w+++l
  Aqcoe1G362500.1.p  61 RGGFKEDEIDLIMKLHKLLGNR-WSLIAGRLP-GRTANDIKNYWNSHL 106
                        677999****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.502359IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.5E-21358IPR009057Homeodomain-like
SuperFamilySSF466893.33E-275102IPR009057Homeodomain-like
SMARTSM007175.1E-15757IPR001005SANT/Myb domain
PfamPF002492.1E-15855IPR001005SANT/Myb domain
CDDcd001672.26E-101055No hitNo description
Gene3DG3DSA:1.10.10.604.1E-2359110IPR009057Homeodomain-like
SMARTSM007172.7E-1360108IPR001005SANT/Myb domain
PROSITE profilePS5129419.00260110IPR017930Myb domain
PfamPF002491.7E-1361106IPR001005SANT/Myb domain
CDDcd001677.87E-964106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009753Biological Processresponse to jasmonic acid
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MRNSNVRKGA WNQDEDLLLK RCIEKYGEGN WHQVPMRAGL NRCRKSCRLR WLNYLHPNIK  60
RGGFKEDEID LIMKLHKLLG NRWSLIAGRL PGRTANDIKN YWNSHLSKKL ELCHKEYQPS  120
IMPKTEVIRP HPRTFNANLV RSRGKFILKN QQPQQQKQKQ QQLEQEQYDA VVPTEAELST  180
WWNDLANDSN ISVPNAKEVI PTNSTVENRE AMNPFERTIF DDIAWDDFLA TF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-2281117109B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00213DAPTransfer from AT1G66370Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ9080910.0FJ908091.1 Aquilegia formosa R2R3-myb transcription factor (MYB17) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9FNV97e-61MY113_ARATH; Transcription factor MYB113
TrEMBLC4PAV31e-156C4PAV3_AQUFO; R2R3-myb transcription factor
STRINGVIT_14s0006g01290.t013e-67(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.11e-61myb domain protein 113